PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004671.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 293aa    MW: 33251.6 Da    PI: 8.2922
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004671.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.7e-54101351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL++++++k++++ ++i+evd+yk++Pw+Lp ++  +e+ewyfF++rd+ky++g r+nra+ sgyWkat
  Itr_sc004671.1_g00002.1  10 LPPGFRFHPTDEELIMYYLRNQATSKPCPV-SIIPEVDVYKFDPWELPDRAGFGENEWYFFTPRDRKYPNGIRPNRAAVSGYWKAT 94 
                              79****************************.89***************988899******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+++s +++ vg+kk Lvfy+g+ pkg+ktdW+mheyrl
  Itr_sc004671.1_g00002.1  95 GTDKAIYS-GSKYVGVKKALVFYQGKPPKGTKTDWIMHEYRL 135
                              ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-667162IPR003441NAC domain
PROSITE profilePS5100561.43910162IPR003441NAC domain
PfamPF023656.1E-2711135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MVAKNRSSDL PPGFRFHPTD EELIMYYLRN QATSKPCPVS IIPEVDVYKF DPWELPDRAG  60
FGENEWYFFT PRDRKYPNGI RPNRAAVSGY WKATGTDKAI YSGSKYVGVK KALVFYQGKP  120
PKGTKTDWIM HEYRLSDSRS HPPKQNGSMR LDDWVLCRIY KKKSMGSNRA MEMVKVEEET  180
QLPQVNIATN CEPLIGSGPQ GLILPRPCSL THLLELGYLG SIPQLLGEDD NNNNFHNYPN  240
LDHHQSPFMG SNGNNVPFAL GESTPQHQYS SQSGFSNNQP MPIFVNPVAF QFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-721016417167NO APICAL MERISTEM PROTEIN
1ut4_B2e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_A2e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_B2e-721016417167NO APICAL MERISTEM PROTEIN
3swm_A2e-721016420170NAC domain-containing protein 19
3swm_B2e-721016420170NAC domain-containing protein 19
3swm_C2e-721016420170NAC domain-containing protein 19
3swm_D2e-721016420170NAC domain-containing protein 19
3swp_A2e-721016420170NAC domain-containing protein 19
3swp_B2e-721016420170NAC domain-containing protein 19
3swp_C2e-721016420170NAC domain-containing protein 19
3swp_D2e-721016420170NAC domain-containing protein 19
4dul_A2e-721016417167NAC domain-containing protein 19
4dul_B2e-721016417167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598866.11e-142PREDICTED: NAC transcription factor 29-like
RefseqXP_016492232.11e-142PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-108NAC29_ARATH; NAC transcription factor 29
TrEMBLX5HYE61e-137X5HYE6_IPONI; Transcription factor InNAP
STRINGPGSC0003DMT4000073411e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-108NAC-like, activated by AP3/PI